Research Peptides
Hormonal & Growth Factor Regulation
Sale!
Research Peptides
Hormonal & Growth Factor Regulation

IGF-1 LR3 1mg

Long R3 insulin-like growth factor-1 (also known as IGF-1 LR3 or Long R3 IGF-1)

SKU: IG1

Original price was: $130,00.Current price is: $111,00.

IGF-1 LR3 1 mg is a modified insulin-like growth factor research peptide containing an N-terminal extension and an Arg3 substitution. Supplied in lyophilized form, its defined 83-amino-acid structure supports laboratory research involving peptide characterization, molecular structure, analytical testing, and modified IGF-related peptide systems.

  • Designation: Laboratory Research Peptide
  • Alternative Name: IGF-1 LR3 / Long R3 IGF-1
  • Peptide Class: Modified Insulin-Like Growth Factor Peptide
  • Molecular Formula: C400H625N111O115S9
  • Molecular Weight: 9111 g/mol
  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • CAS Number: 946870-92-4

Note: IGF-1 LR3 contains an N-terminal extension and Arg3 substitution relative to native IGF-1 and consists of 83 amino-acid residues.

Link to Verify COA at Janoshik.com

500 in stock

High Purity Peptides
Quality Assured
Rigorous Quality Control
Research Use Policy
Research Use Only
3rd-Party Tested
COA Verified

Description

Product Overview

IGF-1 LR3 1 mg is a synthetic research peptide supplied in lyophilized powder form and manufactured to research-grade purity standards. Each vial is sealed to preserve peptide integrity, stability, and consistency, supporting accurate handling and reproducibility in controlled laboratory research environments.

In non-clinical research settings, IGF-1 LR3 is commonly referenced in experimental and in vitro studies examining insulin-like growth factor signaling pathways, IGF receptor interactions, and downstream cellular response mechanisms. Its modified long-acting molecular structure makes it suitable for use as a peptide reference material in analytical testing, assay development, and exploratory laboratory investigations where extended peptide activity is evaluated under controlled conditions.

This product is supplied exclusively for laboratory research use. It is not approved for human or veterinary administration, medical treatment, or diagnostic purposes and must be handled only by qualified professionals in accordance with applicable laboratory regulations.

Research Background

IGF-1 LR3 is a synthetic analog of insulin-like growth factor-1, structurally modified to enhance stability and reduce protein binding in research models. It is referenced in preclinical and laboratory research literature focused on cell growth signaling, IGF-1 receptor activity, and intracellular molecular response pathways. In controlled laboratory environments, IGF-1 LR3 is utilised for studying receptor binding behavior, signal transduction mechanisms, and peptide stability in non-clinical, in vitro systems.

Research Characteristics (Non-Therapeutic)

  • Referenced in IGF and cell signaling research models
  • Suitable for controlled laboratory and in vitro investigations
  • Modified molecular structure supporting research stability
  • High-purity lyophilized format for experimental consistency
  • Intended for professional research use onl

Product Specifications

  • Peptide Name: IGF-1 LR3
  • Quantity: 1 mg per vial
  • Form: Lyophilized powder
  • Appearance: White to off-white solid
  • Purity: Research-grade (see Certificate of Analysis where available)
  • Packaging: Sealed laboratory research vial

Storage & Handling

Store the lyophilized peptide at 28°C for optimal stability. For long-term storage, freezing is recommended where applicable. Protect from light, heat, and moisture. Once handled or reconstituted for research purposes, follow established laboratory protocols for storage, usage, and disposal.

Additional information

Weight 9,2 g
Dimensions 54 × 25 × 54 cm

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.

IGF-1 LR3 1mg

Long R3 insulin-like growth factor-1 (also known as IGF-1 LR3 or Long R3 IGF-1)

Used For

  • IGF-1 LR3 1mg is a specialised research peptide analogue used to investigate insulin-like growth factor signaling and IGF receptor pathways. Its modified structure makes it useful for experimental studies of cellular proliferation, growth-factor signaling, and downstream intracellular mechanisms.
  • IGF-1 LR3 supports research into IGF receptor activity, PI3K-AKT signaling, MAPK pathways, cellular growth, protein metabolism, and tissue-associated cellular biology. It provides researchers with a focused model for studying growth-factor signaling and peptide structure-activity relationships.
For Research Use Only
Storage & Handling IGF-1 LR3 1mg should be stored refrigerated at 28°C (36-46°F), protected from light, and kept out of reach of children. Do not freeze. Before use, ensure the solution is clear and free of particles; discard if cloudy or discolored. Follow proper handling and disposal instructions for vials and syringes according to the manufacturer\'s guidelines.