Research Peptides
Immune & Inflammatory Modulation
Sale!
Research Peptides
Immune & Inflammatory Modulation

LL-37 5mg

LL-37 (also known as cathelicidin LL-37 or CAMP-18)

SKU: 375

Original price was: $58,00.Current price is: $50,00.

LL-37 5 mg is a synthetic 37-amino-acid antimicrobial peptide research material supplied in lyophilized form. Its defined sequence and molecular composition provide a discrete peptide system for laboratory research involving analytical characterization, peptide chemistry, structural studies, and controlled investigation of synthetic host-defense peptide materials.

  • Designation: Laboratory Research Peptide
  • Alternative Name: LL-37 / CAP18
  • Peptide Class: Synthetic Antimicrobial Peptide
  • Molecular Formula: C205H340N60O53
  • Molecular Weight: 4492.35 g/mol
  • Sequence: [LL-37, 37 aa]
  • CAS Number: 597562-32-8

Note: LL-37 is a 37-residue cationic peptide derived from the C-terminal region of the human cathelicidin precursor hCAP18.

Link to Verify COA at Janoshik.com

500 in stock

High Purity Peptides
Quality Assured
Rigorous Quality Control
Research Use Policy
Research Use Only
3rd-Party Tested
COA Verified

Description

Product Overview

LL-37 5 mg is a high-purity synthetic antimicrobial peptide supplied in lyophilized form for laboratory and scientific investigation. Manufactured under controlled conditions, this peptide is provided in a sealed vial to support consistency, stability, and accurate handling in research environments.

LL-37 has attracted attention in experimental peptide and biochemical research involving peptide signaling pathways, molecular interaction analysis, receptor pathway studies, and controlled laboratory investigations. Derived from the human cathelicidin peptide family, its 37 amino acid structure makes it suitable for advanced in vitro and experimental scientific applications conducted by qualified professionals.

This product is intended strictly for laboratory research use only. It is not approved for human or veterinary use, administration, or therapeutic purposes.

Research Characteristics (Non-Therapeutic)

  • Studied in experimental peptide and molecular research models
  • Suitable for controlled laboratory and in vitro investigations
  • Synthetic antimicrobial peptide derived from cathelicidin sequences
  • Lyophilized format for enhanced stability and precision handling
  • High-purity peptide produced for research consistency

Product Details

Quantity: 5 mg per vial
Appearance: White to off-white lyophilized solid
Grade: Research use only
Purity: Refer to Certificate of Analysis (COA), if available

Storage & Handling

Store lyophilized peptide at 2-8°C and protect from light. For extended storage, freezing is recommended where appropriate. Avoid exposure to heat and moisture. Once handled or reconstituted for research purposes, follow established laboratory protocols for storage and disposal.

Additional information

Weight 9,2 g
Dimensions 54 × 25 × 54 cm

LL-37 5mg

LL-37 (also known as cathelicidin LL-37 or CAMP-18)

Used For

  • LL-37 5mg is a specialised research peptide used to investigate antimicrobial peptide activity, membrane interactions, and mechanisms associated with innate immune defense. Its interaction with biological membranes makes it useful for experimental studies of microbial and cellular responses.
  • LL-37 supports advanced research into antibacterial, antiviral, antifungal, biofilm, immune-signaling, inflammation, chemotaxis, and tissue-response pathways. It provides researchers with a focused model for studying peptide-membrane interactions, host-defense mechanisms, and peptide-mediated cellular activity.
For Research Use Only
Storage & Handling Store at 2–8 °C | Protect from light