Research Peptides
Tissue Biology
Sale!
Research Peptides
Tissue Biology

TB-500 (Thymosin Beta-4 Acetate) 5mg

Thymosin beta-4 (also known as TB-500 or thymosin beta-4 acetate)

SKU: TB5(BT)

Original price was: $40,00.Current price is: $34,00.

TB-500 5 mg is a synthetic thymosin beta-4-related research peptide supplied in lyophilized form. Its defined peptide material is provided for laboratory research involving analytical characterization, molecular structure, peptide chemistry, and controlled investigation of synthetic thymosin-related research compounds.

  • Designation: Laboratory Research Peptide
  • Alternative Name: TB-500 / Thymosin Beta-4 Acetate
  • Peptide Class: Synthetic Thymosin-Related Peptide
  • Molecular Formula: C212H350N56O78S
  • Molecular Weight: 4963.44 g/mol
  • Sequence: MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • CAS Number: 77591-33-4

Note: TB-500 is commonly identified as a synthetic thymosin beta-4-related research material. Product-specific analytical documentation should be used to confirm the exact supplied molecular form.

Link to Verify COA at Janoshik.com

500 in stock

High Purity Peptides
Quality Assured
Rigorous Quality Control
Research Use Policy
Research Use Only
3rd-Party Tested
COA Verified

Description

Product Overview

TB-500 5 mg is a laboratory-supplied research peptide provided in lyophilized powder form and manufactured to research-grade purity standards. Each vial is sealed to preserve compound integrity, stability, and consistency, supporting accurate handling and reproducible results within controlled laboratory research environments.

In non-clinical research settings, TB-500 is commonly referenced in experimental and analytical studies examining peptide–actin interactions, intracellular structural dynamics, and cytoskeletal-related signaling mechanisms under defined in vitro conditions. As a synthetic peptide corresponding to a fragment of thymosin beta-4, TB-500 features a well-characterised molecular structure that supports its use as a reference compound in peptide research, assay validation, and exploratory laboratory investigations.

This product is supplied exclusively for laboratory research use. It is not approved for human or veterinary administration, medical treatment, or diagnostic purposes and must be handled only by qualified professionals in accordance with applicable laboratory regulations.

Research Background

TB-500 is a synthetic peptide widely referenced in preclinical and laboratory research literature focused on actin-binding behavior, cytoskeletal organization, and peptide-mediated cellular interaction models. In controlled, non-clinical research environments, TB-500 is utilised to investigate peptide protein binding dynamics, intracellular structural response mechanisms, and molecular interaction pathways in in vitro systems.

Due to its defined amino acid sequence and documented presence in experimental research, TB-500 is frequently included in laboratory studies examining peptide structure function relationships and cytoskeletal-associated signaling behavior under controlled conditions.

Research Characteristics (Non-Therapeutic)

  • Referenced in cytoskeletal and actin-interaction research
  • Suitable for controlled laboratory and in vitro investigations
  • Lyophilized format supporting compound stability and consistency
  • Defined molecular profile for reproducible analytical outcomes
  • Intended for professional laboratory research use only

Product Specifications

  • Compound: TB-500 (Thymosin Beta-4 Fragment)
  • Quantity: 5 mg per vial
  • Form: Lyophilized powder
  • Appearance: White to off-white solid
  • Purity: Research-grade (see Certificate of Analysis where available)
  • Packaging: Sealed laboratory research vial

Storage & Handling

Store the lyophilized compound at 28°C to maintain optimal stability. For long-term storage, freezing may be applied where appropriate. Protect from light, heat, and moisture. Once handled or prepared for research purposes, follow established laboratory protocols for storage, usage, and disposal in compliance with applicable regulations.

Additional information

Weight 9,2 g
Dimensions 54 × 25 × 54 cm

1 review for TB-500 (Thymosin Beta-4 Acetate) 5mg

  1. admin

    We’ve been bringing in TB-500 for ongoing research work, and this batch from the current supplier has been consistent with what we expect at scale. Vials arrived well-packaged, clearly labeled, and accompanied by documentation without needing multiple follow-ups. That alone puts them ahead of a lot of vendors we’ve dealt with.

    From a handling standpoint, reconstitution was straightforward and the material behaved consistently across multiple runs. We’ve seen less variability compared to some previous sources, which is important when you’re working through larger sequences of testing.

    We’re based in Delaware and typically order in bulk, so reliability on fulfillment matters—so far, they’ve been on point with timelines and order accuracy. Feels more like working with a direct manufacturer than a middleman.

    Distefano, Delaware (USA)

Only logged in customers who have purchased this product may leave a review.

TB500 5mg

Thymosin beta-4 (also known as TB-500 or thymosin beta-4 acetate)

Used For

  • TB-500 5mg is a specialised research peptide based on thymosin beta-4 biology and used to investigate cellular migration, cytoskeletal processes, tissue response, and regenerative pathways. Its peptide structure makes it useful for experimental studies involving actin-associated mechanisms and cellular movement.
  • TB-500 supports research into cell migration, angiogenesis, extracellular-matrix activity, actin regulation, inflammatory signaling, oxidative stress, and tissue biology. It provides researchers with a focused model for investigating cellular response mechanisms and peptide-mediated biological activity.
For Research Use Only
Storage & Handling TB500 5mg should be stored as a lyophilized powder in the refrigerator at 28°C (36-46°F), protected from light and moisture. After reconstitution with sterile or bacteriostatic water, keep it refrigerated and use within 2-4 weeks, avoiding repeated freeze-thaw cycles. Always handle with sterile technique and use a new needle for each withdrawal to maintain purity and effectiveness.